PPIRE05790
Target Protein Information
| Protein_Name | Arginase-1 |
|---|---|
| Protein_Sequence | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK |
| Organism_Source | Homo sapiens |
| Functional_Classification | metalloproteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | ARG1 |
| UniProt_ID | P05089 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | REGNH |
|---|---|
| Peptide_Sequence | REGNH |
| Peptide_Length | 5 |
| Peptide_SMILES | N=C(N)NCCC[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 611.62 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 0.09067 |
| Isoelectric_Point | 7.55131 |
|---|---|
| Hydrogen_Bond_Acceptors | 10 |
| Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 350.69000 |
| X_logP_energy | -5.06183 |
Interaction Information
| Affinity | IC50=2.4 mM |
|---|---|
| Affinity_Assay | colorimetric measurement |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A synthetic peptide as an allosteric inhibitor of human arginase I and II. |
| Release_Year | 2021 |
| PMID | 33590412 |
| DOI | 10.1007/s11033-021-06176-5 |