PPIRE05954
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MLWLGWVKTFILKGGKLLFSEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
| Organism_Source | Sus scrofa |
| Functional_Classification | calcium-binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | CALM1 |
| UniProt_ID | A0A4X1SUB1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Dynorphin-1-5 |
|---|---|
| Peptide_Sequence | YGGFL |
| Peptide_Length | 5 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 555.63 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.40000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Hydrogen_Bond_Acceptors | 7 |
| Hydrogen_Bond_Donors | 7 |
| Topological_Polar_Surface_Area | 199.95000 |
| X_logP_energy | -0.16260 |
Interaction Information
| Affinity | KD=300 uM |
|---|---|
| Affinity_Assay | fluorescence enhancement (dansyl probe) |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Construction of a synthetic gene for the metalloregulatory protein MerR and analysis of regionally mutated proteins for transcriptional regulation. |
| Release_Year | 1984 |
| PMID | 8155633 |
| DOI | 10.1021/bi00180a010 |