PPIRE06000
Target Protein Information
| Protein_Name | Delta-type opioid receptor |
|---|---|
| Protein_Sequence | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Oprd1 |
| UniProt_ID | P33533 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | BI360 |
|---|---|
| Peptide_Sequence | YwGFM |
| Peptide_Length | 5 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 702.83 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.60000 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Hydrogen_Bond_Acceptors | 8 |
| Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 215.74000 |
| X_logP_energy | 1.63700 |
Interaction Information
| Affinity | IC50=0.08 uM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding of growth hormone-releasing hormones and enkephalin-derived growth hormone-releasing peptides to mu and delta opioid receptors in forebrain of rat |
| Release_Year | 1988 |
| PMID | 2853311 |
| DOI | 10.1016/0028-3908(88)90062-7 |