PPIRE06114
Target Protein Information
| Protein_Name | Alpha-bungarotoxin isoform V31 |
|---|---|
| Protein_Sequence | MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG |
| Organism_Source | Bungarus multicinctus |
| Functional_Classification | neurotoxins |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P60616 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p6.7 |
|---|---|
| Peptide_Sequence | HRYYESSLEPWYPD |
| Peptide_Length | 14 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)Cc1c[nH]cn1)C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1841.95 |
|---|---|
| Aliphatic_Index | 27.85714 |
| Aromaticity | 0.28571 |
| Average_Rotatable_Bonds | 3.64286 |
| Charge_at_pH_7 | -1.90966 |
| Isoelectric_Point | 4.42146 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 743.46000 |
| X_logP_energy | -4.25393 |
Interaction Information
| Affinity | IC50=16 nM |
|---|---|
| Affinity_Assay | radioimmunoassay |
| PDB_ID | 1JBD |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A branched peptide mimotope of the nicotinic receptor binding site is a potent synthetic antidote against the snake neurotoxin alpha-bungarotoxin. |
| Release_Year | 2002 |
| PMID | 12162733 |
| DOI | 10.1021/bi0256025 |