PPIRE06174
Target Protein Information
| Protein_Name | TPR repeat-containing protein associated with Hsp90 |
|---|---|
| Protein_Sequence | MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS |
| Organism_Source | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Functional_Classification | tetratricopeptide repeat proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TAH1 |
| UniProt_ID | P25638 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MEEVD |
|---|---|
| Peptide_Sequence | MEEVD |
| Peptide_Length | 5 |
| Peptide_SMILES | CSCC[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 621.66 |
|---|---|
| Aliphatic_Index | 58.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.20000 |
| Charge_at_pH_7 | -2.99802 |
| Isoelectric_Point | 3.42471 |
|---|---|
| Hydrogen_Bond_Acceptors | 10 |
| Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 291.62000 |
| X_logP_energy | -2.04910 |
Interaction Information
| Affinity | KD=0.55 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2L6J |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of minimal tetratricopeptide repeat domain protein Tah1 reveals mechanism of its interaction with Pih1 and Hsp90. |
| Release_Year | 2012 |
| PMID | 22179618 |
| DOI | 10.1074/jbc.M111.287458 |