PPIRE06177
Target Protein Information
| Protein_Name | Chromobox protein homolog 7 |
|---|---|
| Protein_Sequence | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromodomains |
| Cellular_Localization | Nucleus |
| Gene_Names | CBX7 |
| UniProt_ID | O95931 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Compound 63 |
|---|---|
| Peptide_Sequence | FXLXs |
| Peptide_Length | 5 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@@H](N)Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | X2=cyclopropylglycine; X4=trimethyllysine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Monomethyl Terephthalate,2-Amino-1,3-Propanediol |
| C-terminal_Modification | 3-propanediol |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 479.53 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 2.80000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 7 |
| Hydrogen_Bond_Donors | 7 |
| Topological_Polar_Surface_Area | 199.95000 |
| X_logP_energy | -2.11860 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Chromodomain antagonists that target the polycomb-group methyllysine reader protein chromobox homolog 7 (CBX7). |
| Release_Year | 2014 |
| PMID | 24625057 |
| DOI | 10.1021/jm401487x |