PPIRE06518
Target Protein Information
| Protein_Name | Pancreatic alpha-amylase |
|---|---|
| Protein_Sequence | MKFVLLLSLIGFCWAQYDPHTADGRTAIVHLFEWRWADIAKECERYLAPKGFGGVQVSPPNENIIINNPSRPWWERYQPISYKICSRSGNENEFKDMVTRCNNVGVRIYVDAVINHMCGSGNSAGTHSTCGSYFNPNNREFSAVPYSAWYFNDNKCNGEINNYNDANQVRNCRLSGLLDLALDKDYVRTKVADYMNNLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPTDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRRTRNFQNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFANWWDNGSNQVAFSRGNRGFIVFNNDDWALSSTLQTGLPAGTYCDVISGDKVNGNCTGLKVNVGSDGKAHFSISNSAEDPFIAIHADSKL |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | glycoside hydrolases |
| Cellular_Localization | Extracellular |
| Gene_Names | Amy2 |
| UniProt_ID | P00689 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PBP1 |
|---|---|
| Peptide_Sequence | PPHMLP |
| Peptide_Length | 6 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 690.86 |
|---|---|
| Aliphatic_Index | 65.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.66667 |
| Charge_at_pH_7 | 0.08889 |
| Isoelectric_Point | 7.55032 |
|---|---|
| Hydrogen_Bond_Acceptors | 9 |
| Hydrogen_Bond_Donors | 6 |
| Topological_Polar_Surface_Area | 205.93000 |
| X_logP_energy | 0.02440 |
Interaction Information
| Affinity | IC50=6.08 mM |
|---|---|
| Affinity_Assay | DNS assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The investigation of Alpha-amylase inhibitory activity of selected Pinto bean peptides via preclinical study using AR42J cell |
| Release_Year | 2017 |
| PMID | None |
| DOI | 10.1016/j.jff.2017.06.037 |