PPIRE06728
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDINLPGRWKPKMIGXIGGFIKVRQYDQVLIEICGHKAIGTVLXGPTPVNIIGRNLLTQIGCTLNF |
| Organism_Source | Human immunodeficiency virus |
| Functional_Classification | proteases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | pro |
| UniProt_ID | H6WVQ6 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pepstatin A |
|---|---|
| Peptide_Sequence | XXXXXX |
| Peptide_Length | 6 |
| Peptide_SMILES | NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 360.33 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 1.83333 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 7 |
| Hydrogen_Bond_Donors | 7 |
| Topological_Polar_Surface_Area | 208.82000 |
| X_logP_energy | -5.38930 |
Interaction Information
| Affinity | IC50=0.7 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Activity of purified biosynthetic proteinase of human immunodeficiency virus on natural substrates and synthetic peptides. |
| Release_Year | 1989 |
| PMID | 2644644 |
| DOI | 10.1073/pnas.86.3.807 |