PPIRE06878
Target Protein Information
| Protein_Name | AP-3 complex subunit mu-2 |
|---|---|
| Protein_Sequence | MIHSLFLINSAGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVVEEIDAIIDKSGSTVTAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHSISFRDSGSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMGLQVGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | adaptor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Ap3m2 |
| UniProt_ID | P53678 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | TGN38 cytosolic tail peptide |
|---|---|
| Peptide_Sequence | SDYQRL |
| Peptide_Length | 6 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 780.84 |
|---|---|
| Aliphatic_Index | 65.00000 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 4.16667 |
| Charge_at_pH_7 | -0.00242 |
| Isoelectric_Point | 6.33190 |
|---|---|
| Hydrogen_Bond_Acceptors | 12 |
| Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 391.57000 |
| X_logP_energy | -4.18753 |
Interaction Information
| Affinity | KD=14 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4IKN |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for the recognition of tyrosine-based sorting signals by the Mu3A subunit of the AP-3 adaptor complex. |
| Release_Year | 2013 |
| PMID | 23404500 |
| DOI | 10.1074/jbc.M113.450775 |