PPIRE06894
Target Protein Information
| Protein_Name | Protein phosphatase 3 catalytic subunit alpha |
|---|---|
| Protein_Sequence | MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine-threonine phosphatases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PPP3CA |
| UniProt_ID | Q08209 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AKAP79 AIAIIIT |
|---|---|
| Peptide_Sequence | AIAIIIT |
| Peptide_Length | 7 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)N)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 713.92 |
|---|---|
| Aliphatic_Index | 251.42857 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.14286 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 9 |
| Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 258.15000 |
| X_logP_energy | -0.08790 |
Interaction Information
| Affinity | Ki=3.7 uM |
|---|---|
| Affinity_Assay | competitive radioligand binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Balanced interactions of calcineurin with AKAP79 regulate Ca2+-calcineurin-NFAT signaling. |
| Release_Year | 2012 |
| PMID | 22343722 |
| DOI | 10.1038/nsmb.2238 |