PPIRE06923
Target Protein Information
| Protein_Name | Folate receptor alpha |
|---|---|
| Protein_Sequence | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | folate receptors |
| Cellular_Localization | Plasma membrane |
| Gene_Names | FOLR1 |
| UniProt_ID | P15328 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | folate-peptide-CPT |
|---|---|
| Peptide_Sequence | CEDRDDC |
| Peptide_Length | 7 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Folate |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 854.86 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | -3.12285 |
| Isoelectric_Point | 3.69899 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 449.02000 |
| X_logP_energy | -6.28113 |
Interaction Information
| Affinity | IC50=10 nM |
|---|---|
| Affinity_Assay | tritiated thymidine incorporation assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and activity of a folate peptide camptothecin prodrug. |
| Release_Year | 2006 |
| PMID | 16901694 |
| DOI | 10.1016/j.bmcl.2006.07.076 |