PPIRE07070
Target Protein Information
| Protein_Name | Gastrin-releasing peptide receptor |
|---|---|
| Protein_Sequence | MDPNNCSHLNLEVDPFLSCNNTFNQTLNPPKMDNWFHPGIIYVIPAVYGLIIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFSDLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYIIPLSIISVYYYFIARNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFITSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPSLLNRSHSTGRSTTCMTSFKSTNPSATFSLINGNICHEGYV |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Grpr |
| UniProt_ID | P52500 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Lys0-Bombesin(7-14) |
|---|---|
| Peptide_Sequence | KWVGHLM |
| Peptide_Length | 7 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCCN)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | 4-Azido-2,3,5,6-Tetrafluorobenzoyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 870.08 |
|---|---|
| Aliphatic_Index | 97.14286 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.85714 |
| Charge_at_pH_7 | 1.08860 |
| Isoelectric_Point | 9.70200 |
|---|---|
| Hydrogen_Bond_Acceptors | 11 |
| Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 308.41000 |
| X_logP_energy | 0.21250 |
Interaction Information
| Affinity | IC50=3.4 nM |
|---|---|
| Affinity_Assay | competitive radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design and synthesis of tryptophan containing dipeptide derivatives as formyl peptide receptor 1 antagonist. |
| Release_Year | 2001 |
| PMID | None |
| DOI | 10.1117/12.432494 |