PPIRE07233
Target Protein Information
| Protein_Name | Translocator protein |
|---|---|
| Protein_Sequence | MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE |
| Organism_Source | Mus musculus |
| Functional_Classification | benzodiazepine receptor |
| Cellular_Localization | Mitochondrion |
| Gene_Names | Tspo |
| UniProt_ID | P50637 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | STHEETS |
|---|---|
| Peptide_Sequence | STHEETS |
| Peptide_Length | 7 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 789.75 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.57143 |
| Charge_at_pH_7 | -1.90756 |
| Isoelectric_Point | 4.25427 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 422.12000 |
| X_logP_energy | -7.25130 |
Interaction Information
| Affinity | IC50=300 uM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of a peptide antagonist to the peripheral-type benzodiazepine receptor that inhibits hormone-stimulated leydig cell steroid formation. |
| Release_Year | 2002 |
| PMID | 12388644 |
| DOI | 10.1124/jpet.102.039388 |