PPIRE07299
Target Protein Information
| Protein_Name | Annexin A5 |
|---|---|
| Protein_Sequence | MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
| Organism_Source | Homo sapiens |
| Functional_Classification | annexins |
| Cellular_Localization | Extracellular |
| Gene_Names | ANXA5 |
| UniProt_ID | P08758 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FBAM-CPGDLSR |
|---|---|
| Peptide_Sequence | XPGDLSR |
| Peptide_Length | 7 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)CN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | X1=N-[6-(4-fluorobenzylidene)aminooxyhexyl]-maleimide |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | N-[6-(4-Fluorobenzylidene)Aminooxyhexyl]-Maleimide |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 700.75 |
|---|---|
| Aliphatic_Index | 55.71429 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -0.00157 |
| Isoelectric_Point | 6.33872 |
|---|---|
| Hydrogen_Bond_Acceptors | 11 |
| Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 348.56000 |
| X_logP_energy | -5.14753 |
Interaction Information
| Affinity | IC50=6 mM |
|---|---|
| Affinity_Assay | radiometric binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Radiopharmacological evaluation of (18)F-labeled phosphatidylserine-binding peptides for molecular imaging of apoptosis. |
| Release_Year | 2015 |
| PMID | 26205076 |
| DOI | 10.1016/j.nucmedbio.2015.06.011 |