PPIRE07356
Target Protein Information
| Protein_Name | Delta-type opioid receptor |
|---|---|
| Protein_Sequence | MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTACTPSDGPGGGAAA |
| Organism_Source | Mus musculus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Oprd1 |
| UniProt_ID | P32300 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Dermenkephalin |
|---|---|
| Peptide_Sequence | YmFHLMD |
| Peptide_Length | 7 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCSC)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 956.14 |
|---|---|
| Aliphatic_Index | 55.71429 |
| Aromaticity | 0.28571 |
| Average_Rotatable_Bonds | 4.14286 |
| Charge_at_pH_7 | -0.91151 |
| Isoelectric_Point | 5.29220 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 324.13000 |
| X_logP_energy | 0.49090 |
Interaction Information
| Affinity | IC50=32.8 nM |
|---|---|
| Affinity_Assay | mouse vas deferens bioassay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Influence of peptidase inhibitors on the apparent agonist potency of delta selective opioid peptides in vitro. |
| Release_Year | 1991 |
| PMID | 1847736 |
| DOI | 10.1016/0024-3205(91)90034-9 |