PPIRE07388
Target Protein Information
| Protein_Name | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform |
|---|---|
| Protein_Sequence | MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL |
| Organism_Source | Homo sapiens |
| Functional_Classification | protein serine/threonine phosphatases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PPP2CA |
| UniProt_ID | P67775 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | [Asp3,ADMAdda5,Dhb7]microcystin-HtyR |
|---|---|
| Peptide_Sequence | aXDRXeX |
| Peptide_Length | 7 |
| Peptide_SMILES | C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)O |
| Chemical_Modification | X2=homotyrosine; X5=9-acetoxy-Adda; X7=dehydrobutyrine |
| Cyclization_Method | Main chain-main chain cyclization; a1<->X7; amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 660.64 |
|---|---|
| Aliphatic_Index | 14.28571 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.14286 |
| Charge_at_pH_7 | -0.99980 |
| Isoelectric_Point | 4.18441 |
|---|---|
| Hydrogen_Bond_Acceptors | 11 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 374.42000 |
| X_logP_energy | -6.17603 |
Interaction Information
| Affinity | IC50=0.06 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Inhibition of several protein phosphatases by a non-covalently interacting microcystin and a novel cyanobacterial peptide, nostocyclin. |
| Release_Year | 2005 |
| PMID | 16046071 |
| DOI | 10.1016/j.bbagen.2005.06.005 |