PPIRE07545
Target Protein Information
| Protein_Name | 14-3-3 protein sigma |
|---|---|
| Protein_Sequence | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Organism_Source | Homo sapiens |
| Functional_Classification | adapter proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SFN |
| UniProt_ID | P31947 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ERalpha-pp |
|---|---|
| Peptide_Sequence | AEGFPAxV |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)N)C(=O)O |
| Chemical_Modification | X7=phosphothreonine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | 5-Fam |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 746.82 |
|---|---|
| Aliphatic_Index | 61.25000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 2.50000 |
| Charge_at_pH_7 | -1.00024 |
| Isoelectric_Point | 3.84998 |
|---|---|
| Hydrogen_Bond_Acceptors | 10 |
| Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 295.53000 |
| X_logP_energy | -2.63580 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Site-Directed Fragment-Based Screening for the Discovery of Protein-Protein Interaction Stabilizers. |
| Release_Year | 2019 |
| PMID | 30707565 |
| DOI | 10.1021/jacs.8b11658 |