PPIRE07564
Target Protein Information
| Protein_Name | Chymotrypsin-C |
|---|---|
| Protein_Sequence | MLGITVFTTFLAYASSCGAPIFQPNLSARVVGGEDAIPHSWPWQISLQYLRDNTWRHTCGGTLITPNHVLTAAHCISNTLTYRVALGKNNLEVEDEAGSLYVGVDTIFVHEKWNSFLVRNDIALIKLAETVELSDTIQVACLPEEGSLLPQDYPCFVTGWGRLYTNGPIAAELQQGLQPVVDYATCSQRDWWGTTVKETMVCAGGDGVISACNGDSGGPLNCQAENGNWDVRGIVSFGSGLSCNTFKKPTVFTRVSAYIDWINQKLQL |
| Organism_Source | Bos taurus |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | CTRC |
| UniProt_ID | Q7M3E1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pep8 |
|---|---|
| Peptide_Sequence | AVPGSWPW |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](C)N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 899.02 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 2.37500 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 10 |
| Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 301.25000 |
| X_logP_energy | -0.44810 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Detection of native peptides as potent inhibitors of enzymes. Crystal structure of the complex formed between treated bovine alpha-chymotrypsin and an autocatalytically produced fragment, IIe-Val-Asn-Gly-Glu-Glu-Ala-Val-Pro-Gly-Ser-Trp-Pro-Trp, at 2.2 angstroms resolution. |
| Release_Year | 2005 |
| PMID | 15654893 |
| DOI | 10.1111/j.1742-4658.2004.04499.x |