PPIRE07688
Target Protein Information
| Protein_Name | Metal-response element-binding transcription factor 2 |
|---|---|
| Protein_Sequence | MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromatin readers |
| Cellular_Localization | Nucleus |
| Gene_Names | MTF2 |
| UniProt_ID | Q9Y483 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3(33-40)K36me3 |
|---|---|
| Peptide_Sequence | GGVKKPHR |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)CNC(=O)CN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | K4=trimethyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 878.05 |
|---|---|
| Aliphatic_Index | 36.25000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.62500 |
| Charge_at_pH_7 | 3.08830 |
| Isoelectric_Point | 11.82306 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 400.85000 |
| X_logP_energy | -4.29603 |
Interaction Information
| Affinity | KD=45 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 5XFR |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Polycomb-like proteins link the PRC2 complex to CpG islands. |
| Release_Year | 2017 |
| PMID | 28869966 |
| DOI | 10.1038/nature23881 |