PPIRE07843
Target Protein Information
| Protein_Name | Renin |
|---|---|
| Protein_Sequence | MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR |
| Organism_Source | Homo sapiens |
| Functional_Classification | aspartic proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | REN |
| UniProt_ID | P00797 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 9 |
|---|---|
| Peptide_Sequence | PHPHXVYK |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)CNC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 934.07 |
|---|---|
| Aliphatic_Index | 36.25000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.12500 |
| Charge_at_pH_7 | 1.17866 |
| Isoelectric_Point | 9.30306 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 347.85000 |
| X_logP_energy | -1.98090 |
Interaction Information
| Affinity | IC50=3 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Cardiotonic agents. 1. Synthesis and structure-activity relationships in a new class of 3-, 4-, and 5-pyridyl-2(1H)-quinolone derivatives. |
| Release_Year | 1987 |
| PMID | 3783603 |
| DOI | 10.1021/jm00162a002 |