PPIRE07928
Target Protein Information
| Protein_Name | 14-3-3 protein epsilon |
|---|---|
| Protein_Sequence | MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | adapter proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | YWHAE |
| UniProt_ID | P62258 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MLF1(29-42)pSer34 |
|---|---|
| Peptide_Sequence | RSXSEPFG |
| Peptide_Length | 8 |
| Peptide_SMILES | N=C(N)NCCC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)O |
| Chemical_Modification | X4=phosphoserine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 835.87 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.12500 |
| Charge_at_pH_7 | -0.00024 |
| Isoelectric_Point | 6.41015 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 397.89000 |
| X_logP_energy | -6.08373 |
Interaction Information
| Affinity | KD=1.55 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 3UAL |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural insights of the MLF1/14-3-3 interaction. |
| Release_Year | 2012 |
| PMID | 22151054 |
| DOI | 10.1111/j.1742-4658.2011.08445.x |