PPIRE08215
Target Protein Information
| Protein_Name | Regulator of G-protein signaling 4 |
|---|---|
| Protein_Sequence | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA |
| Organism_Source | Homo sapiens |
| Functional_Classification | GTPase activating proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | RGS4 |
| UniProt_ID | P49798 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 5nd |
|---|---|
| Peptide_Sequence | YWCKGLCK |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C3<->C7; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1000.24 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 3.87500 |
| Charge_at_pH_7 | 1.87259 |
| Isoelectric_Point | 8.79249 |
|---|---|
| Hydrogen_Bond_Acceptors | 14 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 355.08000 |
| X_logP_energy | -0.74070 |
Interaction Information
| Affinity | IC50=28 uM |
|---|---|
| Affinity_Assay | flow cytometry protein interaction assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A covalent peptide inhibitor of RGS4 identified in a focused one-bead, one compound library screen. |
| Release_Year | 2009 |
| PMID | 19463173 |
| DOI | 10.1186/1471-2210-9-9 |