PPIRE08232
Target Protein Information
| Protein_Name | Interleukin-5 |
|---|---|
| Protein_Sequence | MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
| Organism_Source | Mus musculus |
| Functional_Classification | interleukins |
| Cellular_Localization | Extracellular |
| Gene_Names | Il5 |
| UniProt_ID | P04401 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Thalassospiramide A |
|---|---|
| Peptide_Sequence | XXVXVXVS |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)CNC(=O)CN)C(=O)NCC(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)O)C(C)C)C(C)C |
| Chemical_Modification | X1=dec-3-enoic acid; X2=N-methyltyrosine; X3=4-amino-5-hydroxy-penta-2-enoic acid; X4=4-amino-3,5-dihydroxy-pentanoic acid |
| Cyclization_Method | main chain-main chain cyclization; S8<->X1; amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | None |
| C-terminal_Modification | None |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 630.70 |
|---|---|
| Aliphatic_Index | 108.75000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.37500 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 10 |
| Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 287.25000 |
| X_logP_energy | -4.72220 |
Interaction Information
| Affinity | IC50=10 uM |
|---|---|
| Affinity_Assay | interleukin-5 production inhibition assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Thalassospiramides A and B, immunosuppressive peptides from the marine bacterium Thalassospira sp. |
| Release_Year | 2007 |
| PMID | 17373804 |
| DOI | 10.1021/ol070294u |