PPIRE08317
Target Protein Information
| Protein_Name | Protein YNG1 |
|---|---|
| Protein_Sequence | MEHLANENSDSDIRYSFLSTLDHLPCELIRSLRLMQTIDLFKNEEDEPGMERACRDLLLVATYINDLVDDQIHFLKQHKKELEIQKSVTKNFNSSLENIKSKLTLEEPGAYKEPKLLLKINLKKAKSRERKESITSPTIGINQGDVTEGNNNQEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDCKEIANQRSKSKRQKRRK |
| Organism_Source | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Functional_Classification | PHD fingers |
| Cellular_Localization | Nucleus |
| Gene_Names | YNG1 |
| UniProt_ID | Q08465 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3(1-9)K4me3 peptide |
|---|---|
| Peptide_Sequence | ARTXQTARK |
| Peptide_Length | 9 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X4=trimethyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 988.11 |
|---|---|
| Aliphatic_Index | 22.22222 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.77778 |
| Charge_at_pH_7 | 2.99768 |
| Isoelectric_Point | 12.51648 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 529.49000 |
| X_logP_energy | -8.36946 |
Interaction Information
| Affinity | KD=9.1 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Yng1 PHD finger binding to H3 trimethylated at K4 promotes NuA3 HAT activity at K14 of H3 and transcription at a subset of targeted ORFs. |
| Release_Year | 2006 |
| PMID | 17157260 |
| DOI | 10.1016/j.molcel.2006.10.026 |