PPIRE08335
Target Protein Information
| Protein_Name | Baculoviral IAP repeat-containing protein 7 |
|---|---|
| Protein_Sequence | MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | BIRC7 |
| UniProt_ID | Q96CA5 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Phage-derived peptide |
|---|---|
| Peptide_Sequence | AVPWGLKSE |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](C)N)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 986.14 |
|---|---|
| Aliphatic_Index | 86.66667 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.22222 |
| Charge_at_pH_7 | -0.00054 |
| Isoelectric_Point | 6.40880 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 386.67000 |
| X_logP_energy | -2.15360 |
Interaction Information
| Affinity | Ki=0.42 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure and function analysis of peptide antagonists of melanoma inhibitor of apoptosis (ML-IAP). |
| Release_Year | 2003 |
| PMID | 12846571 |
| DOI | 10.1021/bi034227t |