PPIRE08370
Target Protein Information
| Protein_Name | Urokinase plasminogen activator surface receptor |
|---|---|
| Protein_Sequence | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT |
| Organism_Source | Homo sapiens |
| Functional_Classification | GPI-anchored receptors |
| Cellular_Localization | Plasma membrane |
| Gene_Names | PLAUR |
| UniProt_ID | Q03405 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CB-TE2A-AE105 |
|---|---|
| Peptide_Sequence | DXFsrYLWS |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | X2=cyclohexylalanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Cb-Te2A |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1130.22 |
|---|---|
| Aliphatic_Index | 43.33333 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | -0.00242 |
| Isoelectric_Point | 6.33190 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 471.80000 |
| X_logP_energy | -3.40823 |
Interaction Information
| Affinity | KD=7.7 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Improved PET imaging of uPAR expression using new (64)Cu-labeled cross-bridged peptide ligands: comparative in vitro and in vivo studies. |
| Release_Year | 2013 |
| PMID | 24052804 |
| DOI | 10.7150/thno.6810 |