PPIRE08378
Target Protein Information
| Protein_Name | Microtubule-associated protein 1 light chain 3 beta |
|---|---|
| Protein_Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like modifiers |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAP1LC3B |
| UniProt_ID | Q9GZQ8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PLEKHM1-LIR-VNV-CIL |
|---|---|
| Peptide_Sequence | EDEWCILQY |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1198.31 |
|---|---|
| Aliphatic_Index | 86.66667 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 4.11111 |
| Charge_at_pH_7 | -3.06084 |
| Isoelectric_Point | 3.42471 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 487.13000 |
| X_logP_energy | -1.55920 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and functional analysis of the GABARAP interaction motif (GIM). |
| Release_Year | 2017 |
| PMID | 28655748 |
| DOI | 10.15252/embr.201643587 |