PPIRE08454
Target Protein Information
| Protein_Name | HLA class I histocompatibility antigen, A alpha chain |
|---|---|
| Protein_Sequence | MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class I |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-A |
| UniProt_ID | P04439 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Influenza matrix peptide(58-66) |
|---|---|
| Peptide_Sequence | GILGFVFTL |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 966.19 |
|---|---|
| Aliphatic_Index | 162.22222 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 3.22222 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 11 |
| Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 316.35000 |
| X_logP_energy | 0.20000 |
Interaction Information
| Affinity | KD=5.2 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 2VLL |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The structural dynamics and energetics of an immunodominant T cell receptor are programmed by its Vbeta domain. |
| Release_Year | 2008 |
| PMID | 18275829 |
| DOI | 10.1016/j.immuni.2007.12.018 |