PPIRE08873
Target Protein Information
| Protein_Name | HLA class I histocompatibility antigen, A alpha chain |
|---|---|
| Protein_Sequence | MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class I |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-A |
| UniProt_ID | P04439 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HA-1Phe |
|---|---|
| Peptide_Sequence | VLFDDLLEA |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1034.17 |
|---|---|
| Aliphatic_Index | 173.33333 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | -2.99935 |
| Isoelectric_Point | 3.38003 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 408.02000 |
| X_logP_energy | -0.85220 |
Interaction Information
| Affinity | IC50=15 nM |
|---|---|
| Affinity_Assay | fluorescence-based competition assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Steric hindrance and fast dissociation explain the lack of immunogenicity of the minor histocompatibility HA-1Arg Null allele. |
| Release_Year | 2009 |
| PMID | 19342659 |
| DOI | 10.4049/jimmunol.0803911 |