PPIRE08891
Target Protein Information
| Protein_Name | HLA class I histocompatibility antigen, alpha chain E |
|---|---|
| Protein_Sequence | MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class I |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-E |
| UniProt_ID | P13747 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HLA-G*01 leader peptide |
|---|---|
| Peptide_Sequence | VMAPRTLFL |
| Peptide_Length | 9 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1047.32 |
|---|---|
| Aliphatic_Index | 130.00000 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.44444 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 369.46000 |
| X_logP_energy | -0.80913 |
Interaction Information
| Affinity | KD=1 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 3BZE |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Subtle changes in peptide conformation profoundly affect recognition of the non-classical MHC class I molecule HLA-E by the CD94-NKG2 natural killer cell receptors. |
| Release_Year | 2008 |
| PMID | 18339401 |
| DOI | 10.1016/j.jmb.2008.01.098 |