PPIRE08895
Target Protein Information
| Protein_Name | Voltage-dependent calcium channel gamma-like subunit |
|---|---|
| Protein_Sequence | MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQTICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSGGLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE |
| Organism_Source | Homo sapiens |
| Functional_Classification | aspartic proteinase |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TMEM37 |
| UniProt_ID | Q8WXS4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SP-346 |
|---|---|
| Peptide_Sequence | VSQNYXIVQ |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)C(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)O)C(C)C |
| Chemical_Modification | X6=pipecolic acid |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1007.11 |
|---|---|
| Aliphatic_Index | 107.77778 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.55556 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 465.85000 |
| X_logP_energy | -5.38680 |
Interaction Information
| Affinity | IC50=1.4 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Substitution of proline with pipecolic acid at the scissile bond converts a peptide substrate of HIV proteinase into a selective inhibitor. |
| Release_Year | 1990 |
| PMID | 2190554 |
| DOI | 10.1016/0006-291x(90)91469-9 |