PPIRE09315
Target Protein Information
| Protein_Name | Protein phosphatase 3 catalytic subunit alpha |
|---|---|
| Protein_Sequence | MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine/threonine phosphatases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PPP3CA |
| UniProt_ID | Q08209 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NFATc1 LxVP core peptide(383-392) |
|---|---|
| Peptide_Sequence | DDQYLAVPQH |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1185.26 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -1.91106 |
| Isoelectric_Point | 4.10657 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 526.12000 |
| X_logP_energy | -4.61580 |
Interaction Information
| Affinity | KD=1.6 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Investigating the human Calcineurin Interaction Network using the Pi?LxVP SLiM. |
| Release_Year | 2016 |
| PMID | 27974827 |
| DOI | 10.1038/srep38920 |