PPIRE09322
Target Protein Information
| Protein_Name | 14-3-3 protein zeta/delta |
|---|---|
| Protein_Sequence | MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
| Organism_Source | Homo sapiens |
| Functional_Classification | adapter proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | YWHAZ |
| UniProt_ID | P63104 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Rnd3 peptide |
|---|---|
| Peptide_Sequence | DLRKDKAKSC |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | S9=phosphoserine; C10=farnesyl |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1163.36 |
|---|---|
| Aliphatic_Index | 49.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.30000 |
| Charge_at_pH_7 | 1.93601 |
| Isoelectric_Point | 9.57985 |
|---|---|
| Hydrogen_Bond_Acceptors | 19 |
| Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 560.01000 |
| X_logP_energy | -6.65073 |
Interaction Information
| Affinity | KD=69 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | 14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif to inhibit G proteins. |
| Release_Year | 2013 |
| PMID | 23622247 |
| DOI | 10.1016/j.cell.2013.03.044 |