PPIRE09378
Target Protein Information
| Protein_Name | AP-4 complex subunit mu-1 |
|---|---|
| Protein_Sequence | MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI |
| Organism_Source | Homo sapiens |
| Functional_Classification | adaptor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | AP4M1 |
| UniProt_ID | O00189 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | APP ENPTYKFFEQ |
|---|---|
| Peptide_Sequence | ENPTYKFFEQ |
| Peptide_Length | 10 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1302.41 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.30000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | -0.99961 |
| Isoelectric_Point | 4.25815 |
|---|---|
| Hydrogen_Bond_Acceptors | 18 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 543.69000 |
| X_logP_energy | -3.91830 |
Interaction Information
| Affinity | KD=29.6 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 3L81 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Sorting of the Alzheimer's disease amyloid precursor protein mediated by the AP-4 complex. |
| Release_Year | 2010 |
| PMID | 20230749 |
| DOI | 10.1016/j.devcel.2010.01.015 |