PPIRE09380
Target Protein Information
| Protein_Name | Tyrosine-protein phosphatase non-receptor type 1 |
|---|---|
| Protein_Sequence | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT |
| Organism_Source | Homo sapiens |
| Functional_Classification | protein tyrosine phosphatases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PTPN1 |
| UniProt_ID | P18031 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ac-3 |
|---|---|
| Peptide_Sequence | EPQXAPGENL |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCC(=O)O)C(=O)O |
| Chemical_Modification | X4=di-fluorophosphonomethylphenylalanine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1011.06 |
|---|---|
| Aliphatic_Index | 49.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -1.99847 |
| Isoelectric_Point | 3.61369 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 468.42000 |
| X_logP_energy | -6.02680 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development of accessible peptidic tool compounds to study the phosphatase PTP1B in intact cells. |
| Release_Year | 2014 |
| PMID | 24387659 |
| DOI | 10.1021/cb400903u |