PPIRE09646
Target Protein Information
| Protein_Name | Golgi-associated PDZ and coiled-coil motif-containing protein |
|---|---|
| Protein_Sequence | MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY |
| Organism_Source | Homo sapiens |
| Functional_Classification | PDZ domain proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GOPC |
| UniProt_ID | Q9HD26 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CFTRT3 |
|---|---|
| Peptide_Sequence | TEEEVQTTRL |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)[C@@H](C)O)C(C)C)[C@@H](C)O)[C@@H](C)O)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1205.29 |
|---|---|
| Aliphatic_Index | 68.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.10000 |
| Charge_at_pH_7 | -1.99669 |
| Isoelectric_Point | 3.98005 |
|---|---|
| Hydrogen_Bond_Acceptors | 19 |
| Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 602.80000 |
| X_logP_energy | -7.27083 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Stereochemical preferences modulate affinity and selectivity among five PDZ domains that bind CFTR: comparative structural and sequence analyses. |
| Release_Year | 2014 |
| PMID | 24210758 |
| DOI | 10.1016/j.str.2013.09.019 |