PPIRE09654
Target Protein Information
| Protein_Name | Killer cell immunoglobulin-like receptor 3DL1 |
|---|---|
| Protein_Sequence | MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP |
| Organism_Source | Homo sapiens |
| Functional_Classification | Killer cell immunoglobulin-like receptors |
| Cellular_Localization | Plasma membrane |
| Gene_Names | KIR3DL1 |
| UniProt_ID | P43629 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | T3N |
|---|---|
| Peptide_Sequence | TSNLQEQIGW |
| Peptide_Length | 10 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)[C@@H](C)O)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1175.26 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.80000 |
| Charge_at_pH_7 | -1.00024 |
| Isoelectric_Point | 3.84998 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 548.04000 |
| X_logP_energy | -6.14660 |
Interaction Information
| Affinity | KD=102 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 5T70 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | MHC-I peptides get out of the groove and enable a novel mechanism of HIV-1 escape. |
| Release_Year | 2017 |
| PMID | 28218747 |
| DOI | 10.1038/nsmb.3381 |