PPIRE09921
Target Protein Information
| Protein_Name | Protein AF-9 homolog |
|---|---|
| Protein_Sequence | MAPTISKRIKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPYANPVPNSDNGNEQNTTDHNSKDAEVSSVYFDEIVFNEPNEEFFKILMSRPGNLLPSNKTDDCVYSKQLEQEEIDRIEIGIEKVDKEIDELKQKLENLVKQEAINGS |
| Organism_Source | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Functional_Classification | histone acetylation reader |
| Cellular_Localization | Nucleus |
| Gene_Names | YAF9 |
| UniProt_ID | P53930 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3K27ac peptide |
|---|---|
| Peptide_Sequence | ATKAARKSAPA |
| Peptide_Length | 11 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)O)[C@@H](C)O |
| Chemical_Modification | K7=acetyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1071.24 |
|---|---|
| Aliphatic_Index | 45.45455 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.09091 |
| Charge_at_pH_7 | 2.99739 |
| Isoelectric_Point | 11.82306 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 499.93000 |
| X_logP_energy | -7.25363 |
Interaction Information
| Affinity | KD=10 uM |
|---|---|
| Affinity_Assay | intrinsic tryptophan fluorescence |
| PDB_ID | 6AXJ |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Yaf9 subunit of the NuA4 and SWR1 complexes targets histone H3K27ac through its YEATS domain. |
| Release_Year | 2018 |
| PMID | 29145630 |
| DOI | 10.1093/nar/gkx1151 |