PPIRE09974
Target Protein Information
| Protein_Name | Mitochondrial import receptor subunit TOM20 homolog |
|---|---|
| Protein_Sequence | MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | mitochondrial protein import receptor |
| Cellular_Localization | Mitochondrion |
| Gene_Names | Tomm20 |
| UniProt_ID | Q62760 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pALDH |
|---|---|
| Peptide_Sequence | GPRLSRLLSYA |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)CN)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1232.45 |
|---|---|
| Aliphatic_Index | 115.45455 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.45455 |
| Charge_at_pH_7 | 1.99713 |
| Isoelectric_Point | 11.14762 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 530.02000 |
| X_logP_energy | -4.99846 |
Interaction Information
| Affinity | KD=250 uM |
|---|---|
| Affinity_Assay | NMR titration |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystallographic snapshots of Tom20-mitochondrial presequence interactions with disulfide-stabilized peptides. |
| Release_Year | 2011 |
| PMID | 21591667 |
| DOI | 10.1021/bi200470x |