PPIRE09984
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | antibody |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1 |
| UniProt_ID | P01868 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P11 |
|---|---|
| Peptide_Sequence | HGRVGIYFGMK |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H](N)Cc1c[nH]cn1)C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1264.51 |
|---|---|
| Aliphatic_Index | 61.81818 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 3.72727 |
| Charge_at_pH_7 | 2.08774 |
| Isoelectric_Point | 10.45503 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 491.15000 |
| X_logP_energy | -2.85523 |
Interaction Information
| Affinity | KD=7 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A mutational approach shows similar mechanisms of recognition for the isolated and integrated versions of a protein epitope. |
| Release_Year | 1998 |
| PMID | 9856999 |
| DOI | 10.1074/jbc.273.52.34753 |