PPIRE10082
Target Protein Information
| Protein_Name | Suppressor of cytokine signaling 2 |
|---|---|
| Protein_Sequence | MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SOCS2 |
| UniProt_ID | O14508 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | GHR_pY487 |
|---|---|
| Peptide_Sequence | NIDXFAQVSDI |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(N)=O)[C@@H](C)CC)C(C)C)C(=O)O |
| Chemical_Modification | X4=phosphotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1178.26 |
|---|---|
| Aliphatic_Index | 106.36364 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.45455 |
| Charge_at_pH_7 | -2.00112 |
| Isoelectric_Point | 3.49188 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 535.33000 |
| X_logP_energy | -6.02890 |
Interaction Information
| Affinity | KD=2.3 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural insights into substrate recognition by the SOCS2 E3 ubiquitin ligase. |
| Release_Year | 2019 |
| PMID | 31182716 |
| DOI | 10.1038/s41467-019-10190-4 |