PPIRE10092
Target Protein Information
| Protein_Name | HLA class II histocompatibility antigen, DRB1 beta chain |
|---|---|
| Protein_Sequence | MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class II molecules |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-DRB1 |
| UniProt_ID | P01911 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pyrrolinone-peptide hybrid ligand 20 |
|---|---|
| Peptide_Sequence | PKYXXTLKLAT |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)O)[C@@H](C)O |
| Chemical_Modification | X4=bispyrrolinone scaffold with isopropyl side chain; X5=bispyrrolinone scaffold with N-methyl substitution |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1148.37 |
|---|---|
| Aliphatic_Index | 80.00000 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.36364 |
| Charge_at_pH_7 | 1.99654 |
| Isoelectric_Point | 10.24761 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 453.06000 |
| X_logP_energy | -3.98620 |
Interaction Information
| Affinity | IC50=1.39 uM |
|---|---|
| Affinity_Assay | scintillation proximity assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A high-throughput fluorescence polarization assay for signal transducer and activator of transcription 3. |
| Release_Year | 1999 |
| PMID | None |
| DOI | 10.1021/ja991251e |