PPIRE10102
Target Protein Information
| Protein_Name | Galectin-8 |
|---|---|
| Protein_Sequence | MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW |
| Organism_Source | Homo sapiens |
| Functional_Classification | lectins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | LGALS8 |
| UniProt_ID | O00214 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NDP52_371-381 |
|---|---|
| Peptide_Sequence | QPGLAYGNPYS |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1166.26 |
|---|---|
| Aliphatic_Index | 44.54545 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 2.81818 |
| Charge_at_pH_7 | -0.00372 |
| Isoelectric_Point | 6.08660 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 483.61000 |
| X_logP_energy | -5.38270 |
Interaction Information
| Affinity | KD=5.2 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4GXL |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Sterical hindrance promotes selectivity of the autophagy cargo receptor NDP52 for the danger receptor galectin-8 in antibacterial autophagy. |
| Release_Year | 2013 |
| PMID | 23386746 |
| DOI | 10.1126/scisignal.2003730 |