PPIRE10128
Target Protein Information
| Protein_Name | Neuronal acetylcholine receptor subunit alpha-3 |
|---|---|
| Protein_Sequence | MGVVLLPPPLSMLMLVLMLLPAASASEAEHRLFQYLFEDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSGEGDTPKTRTFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSESVNAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQPLMARDDT |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | ligand-gated ion channels |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Chrna3 |
| UniProt_ID | P04757 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Substance P |
|---|---|
| Peptide_Sequence | RPKPQQFFGLM |
| Peptide_Length | 11 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1348.63 |
|---|---|
| Aliphatic_Index | 35.45455 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 3.81818 |
| Charge_at_pH_7 | 1.99769 |
| Isoelectric_Point | 11.65178 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 510.84000 |
| X_logP_energy | -2.90203 |
Interaction Information
| Affinity | IC50=1 uM |
|---|---|
| Affinity_Assay | radiolabeled norepinephrine release assay |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Desensitization of catecholamine release. The novel catecholamine release-inhibitory peptide catestatin (chromogranin a344-364)acts at the receptor to prevent nicotinic cholinergic tolerance. |
| Release_Year | 1999 |
| PMID | 9915830 |
| DOI | 10.1074/jbc.274.5.2920 |