PPIRE10179
Target Protein Information
| Protein_Name | Gamma-aminobutyric acid receptor-associated protein |
|---|---|
| Protein_Sequence | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GABARAP |
| UniProt_ID | O95166 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CRT(178-188) |
|---|---|
| Peptide_Sequence | SLEDDWDFLPP |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1333.42 |
|---|---|
| Aliphatic_Index | 70.90909 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 3.36364 |
| Charge_at_pH_7 | -3.99890 |
| Isoelectric_Point | 3.26047 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 521.96000 |
| X_logP_energy | -2.40120 |
Interaction Information
| Affinity | KD=11.5 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 3DOW |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural framework of the GABARAP-calreticulin interface--implications for substrate binding to endoplasmic reticulum chaperones. |
| Release_Year | 2009 |
| PMID | 19154346 |
| DOI | 10.1111/j.1742-4658.2008.06857.x |