PPIRE10185
Target Protein Information
| Protein_Name | |
|---|---|
| Protein_Sequence | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED |
| Organism_Source | Human immunodeficiency virus type 1 |
| Functional_Classification | endonucleases |
| Cellular_Localization | Nucleus |
| Gene_Names | |
| UniProt_ID | Q76353 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | a3 |
|---|---|
| Peptide_Sequence | STTVKAASWWA |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CO)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1207.35 |
|---|---|
| Aliphatic_Index | 53.63636 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 3.09091 |
| Charge_at_pH_7 | 0.99769 |
| Isoelectric_Point | 9.70000 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 492.84000 |
| X_logP_energy | -4.71480 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Interfacial peptide inhibitors of HIV-1 integrase activity and dimerization. |
| Release_Year | 2003 |
| PMID | 12643937 |
| DOI | 10.1016/S0960-894X(03)00040-4 |