PPIRE10186
Target Protein Information
| Protein_Name | Suppressor of cytokine signaling 3 |
|---|---|
| Protein_Sequence | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
| Organism_Source | Mus musculus |
| Functional_Classification | negative regulators |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Socs3 |
| UniProt_ID | O35718 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | gp130 pTyr757 phosphopeptide |
|---|---|
| Peptide_Sequence | STVEYSTVVHS |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CO)[C@@H](C)O)C(C)C)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | Y5=phosphotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1208.29 |
|---|---|
| Aliphatic_Index | 79.09091 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.27273 |
| Charge_at_pH_7 | -0.91018 |
| Isoelectric_Point | 5.36345 |
|---|---|
| Hydrogen_Bond_Acceptors | 20 |
| Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 541.68000 |
| X_logP_energy | -7.26830 |
Interaction Information
| Affinity | KD=70 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for phosphotyrosine recognition by suppressor of cytokine signaling-3. |
| Release_Year | 2006 |
| PMID | 16905102 |
| DOI | 10.1016/j.str.2006.06.011 |