PPIRE10224
Target Protein Information
| Protein_Name | DNA repair protein RecO |
|---|---|
| Protein_Sequence | MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE |
| Organism_Source | Escherichia coli (strain SE11) |
| Functional_Classification | recombination mediator proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | recO |
| UniProt_ID | B6I5D9 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | F-SSB-Ct |
|---|---|
| Peptide_Sequence | WYMDFDDDIPF |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Fluorescein |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1463.58 |
|---|---|
| Aliphatic_Index | 35.45455 |
| Aromaticity | 0.36364 |
| Average_Rotatable_Bonds | 3.72727 |
| Charge_at_pH_7 | -4.00108 |
| Isoelectric_Point | 3.22803 |
|---|---|
| Hydrogen_Bond_Acceptors | 18 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 530.75000 |
| X_logP_energy | -0.39180 |
Interaction Information
| Affinity | KD=0.64 mM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 3Q8D |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein. |
| Release_Year | 2011 |
| PMID | 21504984 |
| DOI | 10.1093/nar/gkr199 |