PPIRE10248
Target Protein Information
| Protein_Name | Mu-type opioid receptor |
|---|---|
| Protein_Sequence | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI |
| Organism_Source | Cavia porcellus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | OPRM1 |
| UniProt_ID | P97266 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Dyn A(1-11)-NH2 |
|---|---|
| Peptide_Sequence | YGGFLRRIRPK |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1362.64 |
|---|---|
| Aliphatic_Index | 70.90909 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 3.99683 |
| Isoelectric_Point | 12.22714 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 577.48000 |
| X_logP_energy | -3.78269 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Generation of antitumor peptides by connection of matrix metalloproteinase-9 peptide inhibitor to an endostatin fragment. |
| Release_Year | 1996 |
| PMID | |
| DOI | 10.1021/jm9506463 |