PPIRE10283
Target Protein Information
| Protein_Name | Mitochondrial import receptor subunit TOM20 homolog |
|---|---|
| Protein_Sequence | MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | mitochondrial protein import receptor |
| Cellular_Localization | Mitochondrion |
| Gene_Names | Tomm20 |
| UniProt_ID | Q62760 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pALDH(cxxC)L19S |
|---|---|
| Peptide_Sequence | GcRLCRLSSYA |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CS)NC(=O)CN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; c2<->C5; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1228.45 |
|---|---|
| Aliphatic_Index | 80.00000 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.54545 |
| Charge_at_pH_7 | 1.87318 |
| Isoelectric_Point | 8.80386 |
|---|---|
| Hydrogen_Bond_Acceptors | 19 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 538.81000 |
| X_logP_energy | -6.69116 |
Interaction Information
| Affinity | KD=140 uM |
|---|---|
| Affinity_Assay | NMR titration |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystallographic snapshots of Tom20-mitochondrial presequence interactions with disulfide-stabilized peptides. |
| Release_Year | 2011 |
| PMID | 21591667 |
| DOI | 10.1021/bi200470x |